Mouse Anti-Barrel medic rpl14 Antibody (MO-AB-00541W)
Cat: MO-AB-00541W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Barrel medic (Medicago truncatula) |
Clone | MO00541W |
Specificity | This antibody binds to Barrel medic rpl14. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-Barrel medic rpl14 Antibody is a mouse antibody against rpl14. It can be used for rpl14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 50S ribosomal protein L14p; Ribosomal protein L14; rpl14; MTR_4g051390 |
UniProt ID | G7JQB3 |
Protein Refseq | The length of the protein is 122 amino acids long. The sequence is show below: MIQPQTYLNVADNSGARELMCIRIIGASNRRYAYIGDIVVAVIKKAVPNSSLERSEVIRAVIVRTCKELKRSNGIIIKYDDNAAVLIDKEGNPKGTRIFSAIARELRQLNFTKIVSLAPEVL. |
See other products for " Rpl14 "
CBMOAB-29965FYA | Mouse Anti-D. melanogaster Rpl14 Antibody (CBMOAB-29965FYA) |
MO-AB-28591H | Mouse Anti-Rat Rpl14 Antibody (MO-AB-28591H) |
MO-DKB-01882W | Rabbit Anti-RPL14 Antibody (MO-DKB-01882W) |
CBMOAB-56753FYA | Mouse Anti-Rhesus RPL14 Antibody (CBMOAB-56753FYA) |
MO-AB-28851R | Mouse Anti-Pig RPL14 Antibody (MO-AB-28851R) |
MO-AB-70301W | Mouse Anti-Silkworm RpL14 Antibody (MO-AB-70301W) |
MO-AB-03847Y | Mouse Anti-Chicken RPL14 Antibody (MO-AB-03847Y) |
CBMOAB-09290HCB | Mouse Anti-C. elegans RPL14 Antibody (CBMOAB-09290HCB) |
CBMOAB-89149FYB | Mouse Anti-Rice rpl14 Antibody (CBMOAB-89149FYB) |
CBMOAB-40350FYC | Mouse Anti-Arabidopsis RPL14 Antibody (CBMOAB-40350FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry