Mouse Anti-Silkworm RpL14 Antibody (MO-AB-70301W)


Cat: MO-AB-70301W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO70301W
SpecificityThis antibody binds to Silkworm RpL14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-Silkworm RpL14 Antibody is a mouse antibody against RpL14. It can be used for RpL14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein L14; RpL14
UniProt IDQ5UAS4
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MPFARYVEPGRVALVADGPLKGKLVSVVDVIDQTRALVDGPGSGVPRQQIRLNQLHLTKFRLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEKRAQMTDYDRFKLTAARVKRNRARTAVFKSLKVKAARAGTFGKKNIPKAAAKKVRTKKATKKPAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry