Mouse Anti-C. elegans RPL14 Antibody (CBMOAB-09290HCB)
Cat: CBMOAB-09290HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO09290HB |
Specificity | This antibody binds to C. elegans RPL14. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L14E family of ribosomal proteins. It contains a basic region-leucine zipper (bZIP)-like domain. The protein is located in the cytoplasm. This gene contains a trinucleotide (GCT) repeat tract whose length is highly polymorphic; these triplet repeats result in a stretch of alanine residues in the encoded protein. Transcript variants utilizing alternative polyA signals and alternative 5'-terminal exons exist but all encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-C. elegans RPL14 Antibody is a mouse antibody against RPL14. It can be used for RPL14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein RPL-14; rpl-14 |
UniProt ID | Q9XVE9 |
Protein Refseq | The length of the protein is 135 amino acids long. The sequence is show below: MVFNRVVQIGRVVFIASGKDQGKLAAIVNVIDGNRVQIDGPSSDVTRTVRNLKDLQLTKFVLKLRVGQRTKGVKAAFDAAKVTENFQKTQWAKKIAQRAIRAKLTDFERYKLMKAKQMRNRIVRVELAKLKKAQK. |
See other products for " RPL14 "
CBMOAB-56753FYA | Mouse Anti-Rhesus RPL14 Antibody (CBMOAB-56753FYA) |
MO-AB-00871H | Mouse Anti-Arabidopsis rpl14 Antibody (MO-AB-00871H) |
MO-AB-28591H | Mouse Anti-Rat Rpl14 Antibody (MO-AB-28591H) |
CBMOAB-89149FYB | Mouse Anti-Rice rpl14 Antibody (CBMOAB-89149FYB) |
MO-AB-30504H | Mouse Anti-Sugar beet rpl14 Antibody (MO-AB-30504H) |
MO-AB-70301W | Mouse Anti-Silkworm RpL14 Antibody (MO-AB-70301W) |
MO-AB-07223H | Mouse Anti-Frog rpl14 Antibody (MO-AB-07223H) |
MO-AB-39461W | Mouse Anti-Grape rpl14 Antibody (MO-AB-39461W) |
MO-DKB-01882W | Rabbit Anti-RPL14 Antibody (MO-DKB-01882W) |
MO-AB-19481R | Mouse Anti-Cattle RPL14 Antibody (MO-AB-19481R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry