Mouse Anti-C. elegans TAF9 Antibody (CBMOAB-11888HCB)
Cat: CBMOAB-11888HCB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | C. elegans (Caenorhabditis elegans) |
Clone | MO11888HB |
Specificity | This antibody binds to C. elegans TAF9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16. In human, TAF9 and AK6 (GeneID: 102157402) are two distinct genes that share 5' exons. A similar but distinct gene (TAF9L) has been found on the X chromosome and a pseudogene has been identified on chromosome 19. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-C. elegans TAF9 Antibody is a mouse antibody against TAF9. It can be used for TAF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein TAF-9; taf-9 |
UniProt ID | O45784 |
Protein Refseq | The length of the protein is 183 amino acids long. The sequence is show below: MADTGEKDTETTASGTDGHSKEALAVISMLHECGIQEFDPRVVSMLMDVQYAVTSKILQMSSGLSRHAEKAQIEAEDVQTAADMLGVLTTNAPDREKILQLANDKNQQPLPQIRHNYGLKLPNDRFCQLQQNFVYKADDSYQPMEMQQVTHQPHIIEPPTQVLRPEHVQNMLKRRAPDDDFDS. |
See other products for " TAF9 "
MO-AB-06412W | Mouse Anti-Rhesus TAF9 Antibody (MO-AB-06412W) |
MO-AB-16799W | Mouse Anti-Chimpanzee TAF9 Antibody (MO-AB-16799W) |
CBMOAB-59699FYA | Mouse Anti-Rhesus TAF9 Antibody (CBMOAB-59699FYA) |
MO-AB-29340H | Mouse Anti-Rat Taf9 Antibody (MO-AB-29340H) |
CBMOAB-08574FYB | Mouse Anti-Zebrafish taf9 Antibody (CBMOAB-08574FYB) |
CBMOAB-44792FYC | Mouse Anti-Arabidopsis TAF9 Antibody (CBMOAB-44792FYC) |
MO-AB-65815W | Mouse Anti-Marmoset TAF9 Antibody (MO-AB-65815W) |
MO-AB-21242R | Mouse Anti-Cattle TAF9 Antibody (MO-AB-21242R) |
CBMOAB-04382CR | Mouse Anti-Yeast TAF9 Antibody (CBMOAB-04382CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry