Mouse Anti-Zebrafish taf9 Antibody (CBMOAB-08574FYB)


Cat: CBMOAB-08574FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO08574FYB
SpecificityThis antibody binds to Zebrafish taf9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16. In human, TAF9 and AK6 (GeneID: 102157402) are two distinct genes that share 5' exons. A similar but distinct gene (TAF9L) has been found on the X chromosome and a pseudogene has been identified on chromosome 19. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish taf9 Antibody is a mouse antibody against taf9. It can be used for taf9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor; Taf9 protein; taf
UniProt IDQ0P450
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MASPKTVPKDAQVMMQILKDMGITEYEPRVVNQMLEFTYRYVTTIIEDAKIYSAHAKKSSVDADDIRLAIQCRVDQSFTSPPPRDFLLDIARQKNQTPLPLIKPYTGPRLPPDRYCLTAPNYRLKSLQKKVSSSAGRITVPRLSVGAVSSRPSTPTLGTPSGQTVGTKVGTPVSLTGQRFTVQIPSSQTASVKSATPTTPTVQNVLINPSLIGSKNILITTNMVSQNSSSESTSLKGKHEDEDDYDAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry