Mouse Anti-Cattle TAF9 Antibody (MO-AB-21242R)


Cat: MO-AB-21242R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO21242R
SpecificityThis antibody binds to Cattle TAF9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFunctions as a component of the DNA-binding general transcription factor complex TFIID and the transcription regulatory histone acetylation (HAT) complex SAGA and SLIK. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3, and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus.
Product OverviewThis product is a mouse antibody against TAF9. It can be used for TAF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription initiation factor TFIID subunit 9; TAF9
UniProt IDQ17QQ4
Protein RefseqThe length of the protein is 264 amino acids long.
The sequence is show below: MESGKMASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASASAGRITVPRLSVGSVTSRPSTPTLGTPTPPAMSVSTKVGTPVSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMVSSQNTANEASNALKRKHDDDDDDD.
See other products for " TAF9 "
CBMOAB-59699FYAMouse Anti-Rhesus TAF9 Antibody (CBMOAB-59699FYA)
CBMOAB-11888HCBMouse Anti-C. elegans TAF9 Antibody (CBMOAB-11888HCB)
MO-AB-16799WMouse Anti-Chimpanzee TAF9 Antibody (MO-AB-16799W)
MO-AB-06412WMouse Anti-Rhesus TAF9 Antibody (MO-AB-06412W)
MO-AB-29340HMouse Anti-Rat Taf9 Antibody (MO-AB-29340H)
CBMOAB-08574FYBMouse Anti-Zebrafish taf9 Antibody (CBMOAB-08574FYB)
MO-AB-65815WMouse Anti-Marmoset TAF9 Antibody (MO-AB-65815W)
CBMOAB-44792FYCMouse Anti-Arabidopsis TAF9 Antibody (CBMOAB-44792FYC)
CBMOAB-04382CRMouse Anti-Yeast TAF9 Antibody (CBMOAB-04382CR)
For Research Use Only | Not For Clinical Use.
Online Inquiry