Mouse Anti-Cattle ABCB1 Antibody (MO-AB-06751R)
Cat: MO-AB-06751R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO06751R |
Specificity | This antibody binds to Cattle ABCB1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. Mutations in this gene are associated with colchicine resistance and Inflammatory bowel disease 13. Alternative splicing and the use of alternative promoters results in multiple transcript variants. |
Product Overview | Mouse Anti-Cattle ABCB1 Antibody is a mouse antibody against ABCB1. It can be used for ABCB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette transporter subfamily B member 1, Fragment; ABCB1 |
UniProt ID | B2M0T2 |
Protein Refseq | The length of the protein is 220 amino acids long. The sequence is show below: FSYAGCFRFGAYLVAQGIMEFQDVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSAAHVINIIEKIPLIDSYSTEGLKPSTVEGNVAFNDVVFNYPTRPDIPVLRGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGTVLIDGKEIKQLNVQWLRAHMGIVSQEPILFDCSIGENIAYGDNSRVVSQEEIERAAKEANIHPFIEMLPDKYNTRVG. |
See other products for " Abcb1 "
MO-AB-10588Y | Mouse Anti-O. mykiss Abcb1 Antibody (MO-AB-10588Y) |
CBMOAB-34801FYA | Mouse Anti-Rhesus ABCB1 Antibody (CBMOAB-34801FYA) |
MO-AB-50185W | Mouse Anti-Marmoset ABCB1 Antibody (MO-AB-50185W) |
MO-AB-43544W | Mouse Anti-Horse ABCB1 Antibody (MO-AB-43544W) |
MO-AB-08198W | Mouse Anti-Cat ABCB1 Antibody (MO-AB-08198W) |
MO-AB-23442R | Mouse Anti-Pig ABCB1 Antibody (MO-AB-23442R) |
MO-AB-01127H | Mouse Anti-Frog abcb1 Antibody (MO-AB-01127H) |
MO-AB-28779W | Mouse Anti-Dog ABCB1 Antibody (MO-AB-28779W) |
MO-AB-22804H | Mouse Anti-Mallard ABCB1 Antibody (MO-AB-22804H) |
CBMOAB-1261FYC | Mouse Anti-Arabidopsis ABCB1 Antibody (CBMOAB-1261FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry