Mouse Anti-Cattle AGT Antibody (MO-AB-07142R)


Cat: MO-AB-07142R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07142R
SpecificityThis antibody binds to Cattle AGT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease.
Product OverviewMouse Anti-Cattle AGT Antibody is a mouse antibody against AGT. It can be used for AGT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAngiotensinogen; Angiotensinogen (Serpin peptidase inhibitor, clade A, member 8); AGT
UniProt IDQ3SZH5
Protein RefseqThe length of the protein is 424 amino acids long.
The sequence is show below: MAPAGLSLGAAILCLLAWAGLAAGDRVYVHPFHLLVYSKSNCDQLEKPSVETPPDPTFTPVPIQTKSSAVDEEALWEQLVRATEKLEAEDRLRASEVGLLLNFMGFHMYKTLSETWSVASGAVFSPVALFSTLTSFYVGALDPTASRLQAFLGVPGEGQGCTSRLDGHKVLSSLQTIQGLLVAQGGASSQARLLLSTVVGLFTAPGLHLKQPFVQSLSSFAPITLPRSLDLSTDPNLAAEKINRFMQSVTGWNMG.
For Research Use Only | Not For Clinical Use.
Online Inquiry