Mouse Anti-Chimpanzee agt Antibody (MO-AB-13629W)
Cat: MO-AB-13629W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO13629W |
Specificity | This antibody binds to Chimpanzee agt. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease. |
Product Overview | Mouse Anti-Chimpanzee agt Antibody is a mouse antibody against agt. It can be used for agt detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alanine Glyoxylate Aminotransferase; EC 2.6.1.44; agt |
UniProt ID | Q9TTP2 |
Protein Refseq | The length of the protein is 29 amino acids long. The sequence is show below: MASHKLLVTPPKALLKPLSIPNQLLLGPG. |
See other products for " agt "
CBMOAB-65239FYA | Mouse Anti-Zebrafish agt Antibody (CBMOAB-65239FYA) |
MO-AB-43609W | Mouse Anti-Horse AGT Antibody (MO-AB-43609W) |
MO-AB-07142R | Mouse Anti-Cattle AGT Antibody (MO-AB-07142R) |
MO-AB-01297H | Mouse Anti-Frog agt Antibody (MO-AB-01297H) |
CBMOAB-00769FYA | Mouse Anti-D. melanogaster Agt Antibody (CBMOAB-00769FYA) |
MO-AB-00085Y | Mouse Anti-Chicken AGT Antibody (MO-AB-00085Y) |
MO-AB-26516W | Mouse Anti-Chimpanzee AGT Antibody (MO-AB-26516W) |
MO-AB-10609Y | Mouse Anti-O. mykiss Agt Antibody (MO-AB-10609Y) |
MO-AB-14137Y | Mouse Anti-Sheep AGT Antibody (MO-AB-14137Y) |
CBMOAB-35342FYA | Mouse Anti-Rhesus AGT Antibody (CBMOAB-35342FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry