Mouse Anti-Cattle AK2 Antibody (MO-AB-07174R)


Cat: MO-AB-07174R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07174R
SpecificityThis antibody binds to Cattle AK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenylate kinase is involved in the regulation of intracellular adenine nucleotide composition by catalyzing the reversible transfer of phosphate groups between adenine nucleotides. Three isozymes of adenylate kinase, 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. The expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysplasia. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene have been found on chromosomes 1 and 2. [Provided by RefSeq, November 2010]
Product OverviewMouse Anti-Cattle AK2 Antibody is a mouse antibody against AK2. It can be used for AK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylate kinase 2, mitochondrial; AK 2; EC 2.7.4.3; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinase; [Cleaved into: Adenylate kinase 2, mitochondrial, N-terminally processed]; AK2
UniProt IDP08166
Protein RefseqThe length of the protein is 241 amino acids long.
The sequence is show below: MAPNVPAAEPVPESPKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPQSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI.
For Research Use Only | Not For Clinical Use.
Online Inquiry