Mouse Anti-Cattle ASIP Antibody (MO-AB-07695R)


Cat: MO-AB-07695R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07695R
SpecificityThis antibody binds to Cattle ASIP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionIn mice, the agouti gene encodes a paracrine signaling molecule that causes hair follicle melanocytes to synthesize pheomelanin, a yellow pigment, instead of the black or brown pigment, eumelanin. Pleiotropic effects of constitutive expression of the mouse gene include adult-onset obesity, increased tumor susceptibility, and premature infertility. This gene is highly similar to the mouse gene and encodes a secreted protein that may (1) affect the quality of hair pigmentation, (2) act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone, (3) play a role in neuroendocrine aspects of melanocortin action, and (4) have a functional role in regulating lipid metabolism in adipocytes.
Product OverviewMouse Anti-Cattle ASIP Antibody is a mouse antibody against ASIP. It can be used for ASIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAgouti-signaling protein; ASP; Agouti switch protein; ASIP
UniProt IDQ29414
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MDVSRLLLATLLVCLCFLTAYSHLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC.
For Research Use Only | Not For Clinical Use.
Online Inquiry