Mouse Anti-Cattle BDNF Antibody (MO-AB-08051R)


Cat: MO-AB-08051R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO08051R
SpecificityThis antibody binds to Cattle BDNF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Extracellular region or secreted; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer''s, Parkinson''s, and Huntington''s disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS.
Product OverviewMouse Anti-Cattle BDNF Antibody is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBrain-derived neurotrophic factor; BDNF; BDNF
UniProt IDQ95106
Protein RefseqThe length of the protein is 250 amino acids long.
The sequence is show below: MTILFLTMVISYFGCMKAAPMKEANLRAQGSLAYPGVRTHGTLESMNGPKVGSRGLTSSSSLADTFEHVIEELLDEDQKVRPSEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry