Mouse Anti-Cattle BDNF Antibody (MO-AB-08051R)
Cat: MO-AB-08051R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO08051R |
Specificity | This antibody binds to Cattle BDNF. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Extracellular region or secreted; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer''s, Parkinson''s, and Huntington''s disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. |
Product Overview | Mouse Anti-Cattle BDNF Antibody is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Brain-derived neurotrophic factor; BDNF; BDNF |
UniProt ID | Q95106 |
Protein Refseq | The length of the protein is 250 amino acids long. The sequence is show below: MTILFLTMVISYFGCMKAAPMKEANLRAQGSLAYPGVRTHGTLESMNGPKVGSRGLTSSSSLADTFEHVIEELLDEDQKVRPSEENNKDADMYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR. |
See other products for " BDNF "
MO-DKB-03604W | Rabbit Anti-BDNF (AA 1-100, clone ms2109-012) Antibody (Cat MO-DKB-03604W) |
CBMOAB-67619FYA | Mouse Anti-Zebrafish bdnf Antibody (CBMOAB-67619FYA) |
CBMOAB-36905FYA | Mouse Anti-Rhesus BDNF Antibody (CBMOAB-36905FYA) |
MOFY-0622-FY3 | Mouse Anti-BDNF Antibody (MOFY-0622-FY3) |
MO-AB-43848W | Mouse Anti-Horse BDNF Antibody (MO-AB-43848W) |
MO-DKB-03273W | Rabbit Anti-BDNF Antibody (Cat MO-DKB-03273W) |
CBMOAB-00274FYA | Rabbit Anti-Mouse BDNF Antibody (CBMOAB-00274FYA) |
MO-AB-09229W | Mouse Anti-Cat BDNF Antibody (MO-AB-09229W) |
MO-AB-29235W | Mouse Anti-Dog BDNF Antibody (MO-AB-29235W) |
MOFY-0622-FY118 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY118) |
For Research Use Only | Not For Clinical Use.
Online Inquiry