Mouse Anti-Dog BDNF Antibody (MO-AB-29235W)


Cat: MO-AB-29235W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityDog (Canis lupus familiaris)
CloneMO29235W
SpecificityThis antibody binds to Dog BDNF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Extracellular region or secreted; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders.
Product OverviewMouse Anti-Dog BDNF Antibody is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBrain-derived neurotrophic factor; BDNF
UniProt IDG1K2A0
Protein RefseqThe length of the protein is 320 amino acids long.
The sequence is show below: GTSFPHVRRRLILVKAWNVEFLQKGLHVHTRLGSCPHASSWRDCASQREGCGVEFNTLIPENGLMKFHQVRRVMTILFLTMVISYFGCMKAAPMKEASVRGQGSLAYPGVRTHGTLESVSGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR.
See other products for " BDNF "
MOFY-0722-FY210Rabbit Anti-BDNF Antibody (MOFY-0722-FY210)
MO-NAB-00428WRabbit Anti-BDNF Antibody (C-terminal)
MO-AB-43848WMouse Anti-Horse BDNF Antibody (MO-AB-43848W)
MO-AB-06335YMouse Anti-O. anatinus BDNF Antibody (MO-AB-06335Y)
CBMOAB-36905FYAMouse Anti-Rhesus BDNF Antibody (CBMOAB-36905FYA)
CBMOAB-00274FYARabbit Anti-Mouse BDNF Antibody (CBMOAB-00274FYA)
MOFY-0622-FY3Mouse Anti-BDNF Antibody (MOFY-0622-FY3)
MOFY-0622-FY209Rabbit Anti-BDNF Antibody (MOFY-0622-FY209)
MO-AB-24117RMouse Anti-Pig BDNF Antibody (MO-AB-24117R)
MO-AB-10732YMouse Anti-O. mykiss BDNF Antibody (MO-AB-10732Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry