Mouse Anti-Cattle Cd276 Antibody (MO-AB-09804R)


Cat: MO-AB-09804R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09804R
SpecificityThis antibody binds to Cattle Cd276.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD276 (CD276 Molecule) is a Protein Coding gene. Diseases associated with CD276 include Neuroblastoma and Acute Cervicitis. Among its related pathways are T Cell Co-Signaling Pathway: Ligand-Receptor Interactions and NF-kappaB Signaling. Gene Ontology (GO) annotations related to this gene include receptor binding. An important paralog of this gene is LOC102723996.
Product OverviewMouse Anti-Cattle Cd276 Antibody is a mouse antibody against Cd276. It can be used for Cd276 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD276 antigen, Fragment; Cd276
UniProt IDQ0KIZ6
Protein RefseqThe length of the protein is 528 amino acids long.
The sequence is show below: CGPSSTGVSVAPALGVLWFCLTGAAVEVQVPEDPVVALVGTDATLRCSFSTEPGFSLAQLNLIWQLTDTKQLVHSFAEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVRIRDFGSATVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVLWQDGQGAPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITPHRSPTGAVEVQVPEDPVVA.

Reference

ReferenceKava, R., Peripolli, E., Berton, M. P., Lemos, M., Lobo, R. B., Stafuzza, N. B., ... & Baldi, F. (2021). Genome-wide structural variations in Brazilian Senepol cattle, a tropically adapted taurine breed. Livestock Science, 253, 104708.
For Research Use Only | Not For Clinical Use.
Online Inquiry