Mouse Anti-Chimpanzee CD276 Antibody (MO-AB-20211W)


Cat: MO-AB-20211W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO20211W
SpecificityThis antibody binds to Chimpanzee CD276.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD276 (CD276 Molecule) is a Protein Coding gene. Diseases associated with CD276 include Neuroblastoma and Acute Cervicitis. Among its related pathways are T Cell Co-Signaling Pathway: Ligand-Receptor Interactions and NF-kappaB Signaling. Gene Ontology (GO) annotations related to this gene include receptor binding. An important paralog of this gene is LOC102723996.
Product OverviewMouse Anti-Chimpanzee CD276 Antibody is a mouse antibody against CD276. It can be used for CD276 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD276 molecule; CD276
UniProt IDK7CC44
Protein RefseqThe length of the protein is 316 amino acids long.
The sequence is show below: MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDMVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKCSDSKEDDGQEIA.

Reference

Reference1. Janakiram, M., Shah, U. A., Liu, W., Zhao, A., Schoenberg, M. P., & Zang, X. (2017). The third group of the B7-CD 28 immune checkpoint family: HHLA 2, TMIGD 2, B7x, and B7-H3. Immunological reviews, 276(1), 26-39.
2. Wang, C., Feng, H., Cheng, X., Liu, K., Cai, D., & Zhao, R. (2020). Potential therapeutic targets of B7 family in colorectal cancer. Frontiers in Immunology, 11, 681.
See other products for " cd276 "
CBMOAB-69677FYAMouse Anti-Zebrafish cd276 Antibody (CBMOAB-69677FYA)
MO-AB-01558WMouse Anti-Rhesus CD276 Antibody (MO-AB-01558W)
MO-AB-09804RMouse Anti-Cattle Cd276 Antibody (MO-AB-09804R)
MO-AB-24443RMouse Anti-Pig CD276 Antibody (MO-AB-24443R)
MO-AB-52551WMouse Anti-Marmoset CD276 Antibody (MO-AB-52551W)
CBMOAB-38681FYAMouse Anti-Rhesus CD276 Antibody (CBMOAB-38681FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry