Mouse Anti-Cattle CD8A Antibody (MO-AB-09889R)


Cat: MO-AB-09889R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09889R
SpecificityThis antibody binds to Cattle CD8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8A (CD8a Molecule) is a Protein Coding gene. Diseases associated with CD8A include Cd8 Deficiency, Familial and Primary Cutaneous Aggressive Epidermotropic Cd8+ T-Cell Lymphoma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and T-Cell Receptor and Co-stimulatory Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and coreceptor activity.
Product OverviewMouse Anti-Cattle CD8A Antibody is a mouse antibody against CD8A. It can be used for CD8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD8 alpha chain; CD antigen CD8a; CD8A
UniProt IDP31783
Protein RefseqThe length of the protein is 242 amino acids long.
The sequence is show below: MASLLTALILPLALLLLDAAKVLGSLSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACNIYIWAPLVGTCGVLLLSLVITGICYRRNRRRVCKCPRPVVRQGGKPNLSEKYV.

Reference

ReferenceBednarek, D., Dudek, K., Kwiatek, K., Świątkiewicz, M., Świątkiewicz, S., & Strzetelski, J. (2013). Effect of a diet composed of genetically modified feed components on the selected immune parameters in pigs, cattle, and poultry. Bull Vet Inst Pulawy, 57, 209-2017.
See other products for " CD8A "
CBMOAB-00145FYAMouse Anti-Horse CD8A Antibody (CBMOAB-00145FYA)
CBMOAB-69724FYAMouse Anti-Zebrafish cd8a Antibody (CBMOAB-69724FYA)
CBMOAB-00195FYAMouse Anti-Pig CD8A Antibody (CBMOAB-00195FYA)
MOFY-0522-FY24Mouse Anti-CD8A Antibody (MOFY-0522-FY24)
CBMOAB-00196FYAMouse Anti-Pig CD8A Antibody (CBMOAB-00196FYA)
MO-NAB-00317WRat Anti-Mouse CD8A Antibody
CBMOAB-00169FYAMouse Anti-Goat CD8A Antibody (CBMOAB-00169FYA)
MOFY-0522-FY10Mouse Anti-CD8A Antibody (MOFY-0522-FY10)
MO-AB-52590WMouse Anti-Marmoset CD8A Antibody (MO-AB-52590W)
MOFY-0522-FY53Mouse Anti-CD8A Antibody (MOFY-0522-FY53)
For Research Use Only | Not For Clinical Use.
Online Inquiry