Mouse Anti-Marmoset CD8A Antibody (MO-AB-52590W)


Cat: MO-AB-52590W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52590W
SpecificityThis antibody binds to Marmoset CD8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8A (CD8a Molecule) is a Protein Coding gene. Diseases associated with CD8A include Cd8 Deficiency, Familial and Primary Cutaneous Aggressive Epidermotropic Cd8+ T-Cell Lymphoma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and T-Cell Receptor and Co-stimulatory Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and coreceptor activity.
Product OverviewMouse Anti-Marmoset CD8A Antibody is a mouse antibody against CD8A. It can be used for CD8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD8 alpha; CD8A
UniProt IDQ3LRP5
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MASPVTALLLPLAMLLHAARPSRFRVSPLDRTWNLGDTVELKCEVLLSNPASGCSWLFQPRGAAASPNFLLYISQTKSKVADGLDTQRYSGKKMGDSFILTLSDFREENQGYYFCSALRNSIMYFSSFVPVFLPAKPTTTPAPRPPTPEPTTASQPLSLRPQACRPAAGVAGDTRGLDFACDIYIWVPLAGTCGILLLSLVLTVYCNHRNRRRVCKCPRPAVKSGGKPSLSERCV.

Reference

Reference1. Kohu, K., Yamabe, E., Matsuzawa, A., Onda, D., Suemizu, H., Sasaki, E., ... & Satake, M. (2008). Comparison of 30 immunity-related genes from the common marmoset with orthologues from human and mouse. The Tohoku Journal of Experimental Medicine, 215(2), 167-180.
2. Ma, S., Skarica, M., Li, Q., Xu, C., Risgaard, R. D., Tebbenkamp, A. T., ... & Sestan, N. (2022). Molecular and cellular evolution of the primate dorsolateral prefrontal cortex. Science, 377(6614), eabo7257.
See other products for " CD8A "
CBMOAB-00169FYAMouse Anti-Goat CD8A Antibody (CBMOAB-00169FYA)
CBMOAB-00195FYAMouse Anti-Pig CD8A Antibody (CBMOAB-00195FYA)
MO-AB-41379WMouse Anti-Guinea pig Cd8a Antibody (MO-AB-41379W)
MO-AB-24500RMouse Anti-Pig CD8A Antibody (MO-AB-24500R)
MO-NAB-00316WRat Anti-Mouse CD8A Antibody
CBMOAB-69724FYAMouse Anti-Zebrafish cd8a Antibody (CBMOAB-69724FYA)
MO-AB-08086WMouse Anti-Cat CD8A Antibody (MO-AB-08086W)
MOFY-0522-FY53Mouse Anti-CD8A Antibody (MOFY-0522-FY53)
MO-NAB-00317WRat Anti-Mouse CD8A Antibody
CBMOAB-00176FYAMouse Anti-Rabbit CD8A Antibody (CBMOAB-00176FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry