Mouse Anti-Cat CD8A Antibody (MO-AB-08086W)


Cat: MO-AB-08086W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08086W
SpecificityThis antibody binds to Cat CD8A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD8A (CD8a Molecule) is a Protein Coding gene. Diseases associated with CD8A include Cd8 Deficiency, Familial and Primary Cutaneous Aggressive Epidermotropic Cd8+ T-Cell Lymphoma. Among its related pathways are Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers and T-Cell Receptor and Co-stimulatory Signaling. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and coreceptor activity.
Product OverviewMouse Anti-Cat CD8A Antibody is a mouse antibody against CD8A. It can be used for CD8A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD8 alpha chain; CD antigen CD8a; CD8A
UniProt IDP41688
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MASPVTAQLLPLALLLHAAAAAGPSPFRLSPVRVEGRLGQRVELQCEVLLSSAAPGCTWLFQKNEPAARPIFLAYLSRSRTKLAEELDPKQISGQRIQDTLYSLTLHRFRKEEEGYYFCSVVSNSVLYFSAFVPVFLPVKPTTTPAPRPPTQAPITTSQRVSLRPGTCQPSAGSTVEASGLDLSCDIYIWAPLAGTCAFLLLSLVITVICNHRNRRRVCKCPRPVVRAGGKPSPSERYV.
See other products for " CD8A "
CBMOAB-00081FYAMouse Anti-Cattle CD8A Antibody (CBMOAB-00081FYA)
CBMOAB-00082FYAMouse Anti-Bison CD8A Antibody (CBMOAB-00082FYA)
MO-AB-52590WMouse Anti-Marmoset CD8A Antibody (MO-AB-52590W)
MOFY-0522-FY53Mouse Anti-CD8A Antibody (MOFY-0522-FY53)
CBMOAB-00078FYAMouse Anti-Bison CD8A Antibody (CBMOAB-00078FYA)
MO-AB-23028HMouse Anti-Mallard cd8a Antibody (MO-AB-23028H)
CBMOAB-38745FYAMouse Anti-Rhesus CD8A Antibody (CBMOAB-38745FYA)
CBMOAB-00144FYAMouse Anti-Horse CD8A Antibody (CBMOAB-00144FYA)
MO-AB-29492WMouse Anti-Dog CD8A Antibody (MO-AB-29492W)
CBMOAB-00080FYAMouse Anti-Bison CD8A Antibody (CBMOAB-00080FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry