Mouse Anti-Cattle CMC4 Antibody (MO-AB-10382R)
Cat: MO-AB-10382R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO10382R |
| Specificity | This antibody binds to Cattle CMC4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5'' exon spliced to two different sets of 3'' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria. |
| Product Overview | Mouse Anti-Cattle CMC4 Antibody is a mouse antibody against CMC4. It can be used for CMC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cx9C motif-containing protein 4; Mature T-cell proliferation 1 neighbor protein; CMC4; MTCP1NB |
| UniProt ID | Q0VBY0 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MPQKDPCQKQACEIQKCLQANNYMESKCQAVIEELRKCCARYPKGRSLICSGFEKEEEEKQTLKCTPQ. |
See other products for " CMC4 "
| MO-AB-21747W | Mouse Anti-Chimpanzee CMC4 Antibody (MO-AB-21747W) |
| CBMOAB-00758CR | Mouse Anti-Yeast CMC4 Antibody (CBMOAB-00758CR) |
| CBMOAB-63900FYA | Mouse Anti-Zebrafish cmc4 Antibody (CBMOAB-63900FYA) |
| MO-AB-53231W | Mouse Anti-Marmoset CMC4 Antibody (MO-AB-53231W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry