Mouse Anti-Chimpanzee CMC4 Antibody (MO-AB-21747W)


Cat: MO-AB-21747W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO21747W
SpecificityThis antibody binds to Chimpanzee CMC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Product OverviewMouse Anti-Chimpanzee CMC4 Antibody is a mouse antibody against CMC4. It can be used for CMC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMature T-cell proliferation 1 neighbor; CMC4; MTCP1NB
UniProt IDH2QZB7
Protein RefseqThe length of the protein is 68 amino acids long.
The sequence is show below: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEKLTLKSASK.
For Research Use Only | Not For Clinical Use.
Online Inquiry