Mouse Anti-Zebrafish cmc4 Antibody (CBMOAB-63900FYA)


Cat: CBMOAB-63900FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO63900FYA
SpecificityThis antibody binds to Zebrafish cmc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Product OverviewMouse Anti-Zebrafish cmc4 Antibody is a mouse antibody against cmc4. It can be used for cmc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X9-C Motif Containing 4; cmc4
UniProt IDX1WGW2
Protein RefseqThe length of the protein is 64 amino acids long.
The sequence is show below: MSQKDPCQKQACAIQKCLQANRYIESRCEDVIRAMKKCCELHTGENSVCCSGFAKENKPTDPKT.
See other products for " CMC4 "
CBMOAB-00758CRMouse Anti-Yeast CMC4 Antibody (CBMOAB-00758CR)
MO-AB-53231WMouse Anti-Marmoset CMC4 Antibody (MO-AB-53231W)
MO-AB-21747WMouse Anti-Chimpanzee CMC4 Antibody (MO-AB-21747W)
MO-AB-10382RMouse Anti-Cattle CMC4 Antibody (MO-AB-10382R)
For Research Use Only | Not For Clinical Use.
Online Inquiry