Mouse Anti-Cattle FUT1 Antibody (MO-AB-12754R)


Cat: MO-AB-12754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO12754R
SpecificityThis antibody binds to Cattle FUT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the terminal galactose residue of glycoconjugates through an alpha(1,2) linkage leading to H antigen synthesis that is an intermediate substrate in the synthesis of ABO blood group antigens. H antigen is essential for maturation of the glomerular layer of the main olfactory bulb, in cell migration and early cell-cell contacts during tumor associated angiogenesis (By similarity). Preferentially fucosylates soluble lactose and to a lesser extent fucosylates glycolipids gangliosides GA1 and GM1a (By similarity).
Product OverviewMouse Anti-Cattle FUT1 Antibody is a mouse antibody against FUT1. It can be used for FUT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFucosyltransferase 1; FUT1
UniProt IDQ0V8Q6
Protein RefseqThe length of the protein is 416 amino acids long.
The sequence is show below: MPGPAPDARAWPDSKHPQTPEWKREKSTDRSIRIQHGSCKLDLSVHEKMRLLGRPAMWAPGHRHLCLIFLLTCVFACVFFLLIHQNLFHSGLDLFLLCPDRSRVRSPVAILCLSGTPMNPNATFTCPRHSASVSGTWTIDPKGRFGNQMGQYATLLALAQLNGRQAFIQPSMHAVLAPVFRITLPVLAPEVDRHAPWQELELHDWMSEEYAHLKEPWLKLTGFPCSWTFFHHLRDQIRSEFTLHEHLRQEAQRSL.
See other products for " FUT1 "
MO-AB-00207WMouse Anti-Barrel medic FUT1 Antibody (MO-AB-00207W)
MO-AB-55722WMouse Anti-Marmoset FUT1 Antibody (MO-AB-55722W)
MO-AB-03730HMouse Anti-Frog fut1 Antibody (MO-AB-03730H)
MO-AB-25951RMouse Anti-Pig FUT1 Antibody (MO-AB-25951R)
CBMOAB-33586FYCMouse Anti-Arabidopsis FUT1 Antibody (CBMOAB-33586FYC)
CBMOAB-04211HCBMouse Anti-C. elegans FUT1 Antibody (CBMOAB-04211HCB)
MO-AB-37234WMouse Anti-Goat FUT1 Antibody (MO-AB-37234W)
MO-AB-08143YMouse Anti-Rabbit FUT1 Antibody (MO-AB-08143Y)
MO-DKB-02821WRabbit Anti-FUT1 Antibody (MO-DKB-02821W)
For Research Use Only | Not For Clinical Use.
Online Inquiry