Mouse Anti-Pig FUT1 Antibody (MO-AB-25951R)
Cat: MO-AB-25951R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Pig (Sus scrofa) |
Clone | MO25951R |
Specificity | This antibody binds to Pig FUT1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Golgi apparatus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Catalyzes the transfer of L-fucose, from a guanosine diphosphate-beta-L-fucose, to the terminal galactose residue of glycoconjugates through an alpha(1,2) linkage leading to H antigen synthesis that is an intermediate substrate in the synthesis of ABO blood group antigens. H antigen is essential for maturation of the glomerular layer of the main olfactory bulb, in cell migration and early cell-cell contacts during tumor associated angiogenesis (By similarity). Preferentially fucosylates soluble lactose and to a lesser extent fucosylates glycolipids gangliosides GA1 and GM1a (By similarity). |
Product Overview | This product is a mouse antibody against FUT1. It can be used for FUT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Alpha-1-fucosyltransferase, Fragment; FUT1 |
UniProt ID | M1XGB3 |
Protein Refseq | The length of the protein is 40 amino acids long. The sequence is show below: PKHPASLSGTWTIYPDGRFGNQMGQYATLLALAQLNGRQA. |
See other products for " fut1 "
MO-AB-03730H | Mouse Anti-Frog fut1 Antibody (MO-AB-03730H) |
MO-AB-00207W | Mouse Anti-Barrel medic FUT1 Antibody (MO-AB-00207W) |
MO-AB-37234W | Mouse Anti-Goat FUT1 Antibody (MO-AB-37234W) |
MO-AB-55722W | Mouse Anti-Marmoset FUT1 Antibody (MO-AB-55722W) |
MO-AB-08143Y | Mouse Anti-Rabbit FUT1 Antibody (MO-AB-08143Y) |
CBMOAB-04211HCB | Mouse Anti-C. elegans FUT1 Antibody (CBMOAB-04211HCB) |
MO-AB-12754R | Mouse Anti-Cattle FUT1 Antibody (MO-AB-12754R) |
MO-DKB-02821W | Rabbit Anti-FUT1 Antibody (MO-DKB-02821W) |
CBMOAB-33586FYC | Mouse Anti-Arabidopsis FUT1 Antibody (CBMOAB-33586FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry