Mouse Anti-Goat FUT1 Antibody (MO-AB-37234W)


Cat: MO-AB-37234W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGoat (Capra hircus)
CloneMO37234W
SpecificityThis antibody binds to Goat FUT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
Product OverviewMouse Anti-Goat FUT1 Antibody is a mouse antibody against FUT1. It can be used for FUT1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha(1-2)-fucosyltransferase 1; FUT1
UniProt IDB5AFG2
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: LFLLCPDRSRVTSPVAILCLSGTPVNTNATFSCPKHPASVSGTWTIDPKGRFGNQMGQYATLLALAQLNGCQAFIQPSMHAVLAPVFRITLPVLAPEVDRHAPWQELELHDWMSEEYAHVKEPWVKLTGFPCSWTFFHHLREQIRSEFTLHEHLRQEAQRSLSGLRFPRTGDRPSTFVGVHVRRGDYLQVMPLHWKGVVGDRAYLQQAMDWFRARHKAPIFVVTSNGMEWCRENIDTSRGDVIFAGDGQEGAPHKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSSFLKIFKPE.
For Research Use Only | Not For Clinical Use.
Online Inquiry