Mouse Anti-Cattle GOT2 Antibody (MO-AB-13227R)


Cat: MO-AB-13227R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO13227R
SpecificityThis antibody binds to Cattle GOT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Mitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle GOT2 Antibody is a mouse antibody against GOT2. It can be used for GOT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAspartate aminotransferase, mitochondrial; mAspAT; EC 2.6.1.1; Fatty acid-binding protein; FABP-1; Glutamate oxaloacetate transaminase 2; Kynurenine aminotransferase 4; Kynurenine aminotransferase IV; Kynurenine--oxoglutarate transaminase 4; Kynurenine--o癷?癸GOT2
UniProt IDP12344
Protein RefseqThe length of the protein is 430 amino acids long.
The sequence is show below: MALLHSGRFLSGVAAAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIAGLAEFCKASAELALGENNEVLKSGRYVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQSYRYYDPKTCGFDFTGAIEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATVVKKNNLFAFFDMAYQGFASGDGN.
See other products for " got2 "
MO-AB-03994HMouse Anti-Frog got2 Antibody (MO-AB-03994H)
CBMOAB-17943FYAMouse Anti-D. melanogaster Got2 Antibody (CBMOAB-17943FYA)
MO-AB-00622RMouse Anti-Medaka got2 Antibody (MO-AB-00622R)
CBMOAB-43841FYAMouse Anti-Rhesus GOT2 Antibody (CBMOAB-43841FYA)
MO-AB-07963WMouse Anti-Cat GOT2 Antibody (MO-AB-07963W)
MO-AB-15575YMouse Anti-Sheep GOT2 Antibody (MO-AB-15575Y)
MO-AB-44922WMouse Anti-Horse GOT2 Antibody (MO-AB-44922W)
MO-AB-02192YMouse Anti-Chicken GOT2 Antibody (MO-AB-02192Y)
MO-AB-56199WMouse Anti-Marmoset GOT2 Antibody (MO-AB-56199W)
MO-AB-23263HMouse Anti-Mallard GOT2 Antibody (MO-AB-23263H)
For Research Use Only | Not For Clinical Use.
Online Inquiry