Mouse Anti-Mallard GOT2 Antibody (MO-AB-23263H)


Cat: MO-AB-23263H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMallard (Anas platyrhynchos)
CloneMO23263C
SpecificityThis antibody binds to Mallard GOT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against GOT2. It can be used for GOT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAspartate aminotransferase; EC 2.6.1.1; GOT2
UniProt IDU3IGY5
Protein RefseqThe length of the protein is 427 amino acids long.
The sequence is show below: MSLPCLEVTQGGFALSSSLTLSSFPSSSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYLPIGGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRIGANFLQRFFKSSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFAGAMDDISKIPEKSIILLHACAHNPTGVDPRQEQWKEMAATVKKRNLLVYFDMAYQGFASGDINRDAWAVRHFIEQGINIVLSQSYAKNMGLYGERAGAFTVICSDAEEAKRVESQLKILIRPMYSNPPLNGARIASIILNTPELRKEWLVEVKGMADRIIGMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISMAGVTSGNVGYLAHAIHQVTK.
See other products for " Got2 "
CBMOAB-17943FYAMouse Anti-D. melanogaster Got2 Antibody (CBMOAB-17943FYA)
MO-AB-12615WMouse Anti-Chimpanzee GOT2 Antibody (MO-AB-12615W)
MO-AB-00572LMouse Anti-Elephant GOT2 Antibody (MO-AB-00572L)
MO-AB-56199WMouse Anti-Marmoset GOT2 Antibody (MO-AB-56199W)
MO-AB-15575YMouse Anti-Sheep GOT2 Antibody (MO-AB-15575Y)
MO-AB-02192YMouse Anti-Chicken GOT2 Antibody (MO-AB-02192Y)
MO-AB-07963WMouse Anti-Cat GOT2 Antibody (MO-AB-07963W)
MO-AB-33267HMouse Anti-Nile tilapia got2 Antibody (MO-AB-33267H)
MO-AB-44922WMouse Anti-Horse GOT2 Antibody (MO-AB-44922W)
MO-AB-13227RMouse Anti-Cattle GOT2 Antibody (MO-AB-13227R)
For Research Use Only | Not For Clinical Use.
Online Inquiry