Mouse Anti-Cattle MOCS3 Antibody (MO-AB-15905R)


Cat: MO-AB-15905R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15905R
SpecificityThis antibody binds to Cattle MOCS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a central role in 2-thiolation of mcmSU at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
Product OverviewMouse Anti-Cattle MOCS3 Antibody is a mouse antibody against MOCS3. It can be used for MOCS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Sulfurtransferase MOCS3; Sulfur carrier protein MOCS2A adenylyltransferase; Sulfur carrier protein MOCS2A sulfurtransferase; EC 2.8.1.11; Adenylyltransferase MOCS3; 癷?癸MOCS3; UBA4
UniProt IDA1A4L8
Protein RefseqThe length of the protein is 455 amino acids long.
The sequence is show below: MAAREEVLALQAEVAQREEELSSLKQRLAAALSTGQESARSVPVSPLPPRAALSREEIRRYSRQLVLPELGMQGQLRLAAAAVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEASNLARQVLHGEALAGQAKVFSAAAALRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNAPTRYLVSDACVLAGRPLVSASALRFEGQLTVYHYGGGPCYRCVFPRPPPAETVTSCADGGVLGAVTGVLGCLQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry