Mouse Anti-Elephant MOCS3 Antibody (MO-AB-00820L)
Cat: MO-AB-00820L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana) |
Clone | MO00820L |
Specificity | This antibody binds to Elephant MOCS3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Plays a central role in 2-thiolation of mcmSU at tRNA wobble positions of cytosolic tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions. |
Product Overview | This product is a mouse antibody against MOCS3. It can be used for MOCS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Molybdenum Cofactor Synthesis 3; Ubiquitin-Like Modifier Activating Enzyme 4; Molybdenum Cofactor Synthesis Protein 3; Molybdopterin Synthase Sulfurylase; MPT Synthase Sulfurylase; UBA4; UBA4, Ubiquitin-Activating Enzyme E1 Homolog (Yeast); Adenylyltransferase And Sulfurtransferase MOCS3; UBA4, Ubiquitin-Activating Enzyme E1 Homolog |
UniProt ID | G3TPH1 |
Protein Refseq | The length of the protein is 460 amino acids long. The sequence is show below: MAARDEVLALRTEVAQREEELSSLKQRLAAALLEKQESESERLVLVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLATASVLVVGCGGLGCPLAQYLAAAGVGRIGLVDYDVVEMSNLPRQVLHDEALAGQAKAFSAAAALRRLNSAVECVPYAQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRCIRLRKRRPNCAACGERPTVTDLQDYEAFCGSSATDKCRSLQLLSPKERVSVTEYKQLLDSGTSHLLLDVRPQVEVDICRLPHALHIPLKRLERGDAESLKLLREAVRERKQGVQEGAAVPVYVICKLGNDSQKAVKILQSLTAAQELDSLTVQDVVGGLMAWAAKIDDTFPQY. |
See other products for " MOCS3 "
MO-AB-02945Y | Mouse Anti-Chicken MOCS3 Antibody (MO-AB-02945Y) |
MO-AB-38615W | Mouse Anti-Gorilla MOCS3 Antibody (MO-AB-38615W) |
MO-AB-31815W | Mouse Anti-Dog MOCS3 Antibody (MO-AB-31815W) |
CBMOAB-34680FYB | Mouse Anti-Rice MOCS3 Antibody (CBMOAB-34680FYB) |
MO-AB-31898H | Mouse Anti-Soybean MOCS3 Antibody (MO-AB-31898H) |
MO-AB-59220W | Mouse Anti-Marmoset MOCS3 Antibody (MO-AB-59220W) |
MO-AB-36309W | Mouse Anti-French-bean MOCS3 Antibody (MO-AB-36309W) |
MO-AB-27811W | Mouse Anti-Cottonwood MOCS3 Antibody (MO-AB-27811W) |
CBMOAB-87190FYA | Mouse Anti-Zebrafish mocs3 Antibody (CBMOAB-87190FYA) |
MO-AB-12101Y | Mouse Anti-O. mykiss MOCS3 Antibody (MO-AB-12101Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry