Mouse Anti-Cattle MUS81 Antibody (MO-AB-16238R)
Cat: MO-AB-16238R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO16238R |
| Specificity | This antibody binds to Cattle MUS81. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Interacts with MMS4 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5''-end at the branch nick. Typical substrates include 3''-flap structures, D-loops, replication forks with regressed leading strands and nicked Holliday junctions. Cleavage probably occurs approximately half a helical turn upstream of the free 5''-end in these structures. May be required in mitosis for the processing of stalled replication fork intermediates arising spontaneously or subsequent to treatment with DNA damaging agents such as methylmethane sulfonate (MMS), camptothecin (CPT) or UV. May be required in meiosis for the repair of meiosis-specific double strand breaks subsequent to single-end invasion (SEI). This involves consecutive cleavage of D-loops and nicked Holliday junctions leading to sister chromatid crossover. In contrast to MSH4-MSH5 dependent crossover, double Holliday junctions do not seem to be involved. Spore formation and viability are severely impaired in deletion strains. |
| Product Overview | Mouse Anti-Cattle MUS81 Antibody is a mouse antibody against MUS81. It can be used for MUS81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | MUS81 endonuclease homolog; MUS81 |
| UniProt ID | Q1JPC1 |
| Protein Refseq | The length of the protein is 436 amino acids long. The sequence is show below: MAAPVRLGRKRPLPVCPNPLFVRWLTEWRDEAASRGRRTQFVFQKALRSLRRYPLPLRSGKEAKILQHFGDGLCRMLDQRLQQHKASVGDHAPCSPSGTKSPARERPPAEVQDPSMPVPTQLKAGGPGSYWPARHSGARAVLLQLYREHLNPSGQGFLTKEELLQRCAPKVPRVAPGSARPWPALRSLLHRNLVLRTHQPARYSLTPQGLELAQKLADSEGLGLLNVGSGPEEPRGEEPEVPEVASAELGTSEGS. |
See other products for " MUS81 "
| MO-AB-05381H | Mouse Anti-Frog MUS81 Antibody (MO-AB-05381H) |
| CBMOAB-25173FYA | Mouse Anti-D. melanogaster Mus81 Antibody (CBMOAB-25173FYA) |
| MO-AB-10947W | Mouse Anti-Chimpanzee MUS81 Antibody (MO-AB-10947W) |
| CBMOAB-34761FYB | Mouse Anti-Rice MUS81 Antibody (CBMOAB-34761FYB) |
| CBMOAB-06922HCB | Mouse Anti-C. elegans MUS81 Antibody (CBMOAB-06922HCB) |
| MO-AB-59557W | Mouse Anti-Marmoset MUS81 Antibody (MO-AB-59557W) |
| CBMOAB-36821FYC | Mouse Anti-Arabidopsis MUS81 Antibody (CBMOAB-36821FYC) |
| CBMOAB-51954FYA | Mouse Anti-Rhesus MUS81 Antibody (CBMOAB-51954FYA) |
| CBMOAB-87820FYA | Mouse Anti-Zebrafish mus81 Antibody (CBMOAB-87820FYA) |
| CBMOAB-02517CR | Mouse Anti-Yeast MUS81 Antibody (CBMOAB-02517CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry