Mouse Anti-Frog MUS81 Antibody (MO-AB-05381H)


Cat: MO-AB-05381H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05381C
SpecificityThis antibody binds to Frog MUS81.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a structure-specific endonuclease which belongs to the XPF/MUS81 endonuclease family and plays a critical role in the resolution of recombination intermediates during DNA repair after inter-strand cross-links, replication fork collapse, and DNA double-strand breaks. The encoded protein associates with one of two closely related essential meiotic endonuclease proteins (EME1 or EME2) to form a complex that processes DNA secondary structures. It contains an N-terminal DEAH helicase domain, an excision repair cross complementation group 4 (ERCC4) endonuclease domain, and two tandem C-terminal helix-hairpin-helix domains. Mice with a homozygous knockout of the orthologous gene have significant meiotic defects including the failure to repair a subset of DNA double strand breaks.
Product OverviewThis product is a mouse antibody against MUS81. It can be used for MUS81 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesStructure specific endonuclease subunit MUS81; EC 3.1.22.-; MUS81
UniProt IDA0A068ER06
Protein RefseqThe length of the protein is 613 amino acids long.
The sequence is show below: MPGEITYGRKKTVPACPNPLFLKWLTEWRDSAAEKGLKTQFVYQKAISSIKKYPLPLHSGKEAKILQNFGDSICKMLDDRLEKHYAECGSDAPIHTLPSSSSTHSKAQRQPKNPSPLTIPHELQPPEQESQDPSPSKKKKTGGKKQREYVPQRRSGGYAVLLTLYRETKSPSSRGYMTKAELQKEAQALCDKSFTLTDPNSKYTAWSSVSTLIQKELVIKTHSPARYSLTEKGLELAQKLEEAEDQTRAKGFPKQVQTSSHEEEEQEETDSETNPCTHVEPVQCPPGQQLNVAYSYNVKNTSSVPPSVQYNHVPDFTLRPGDFNILLCVDFIETTGGAAHKKQDLVSELKRNGVNFDVRKLHIGXFLWVAQEKVQPVPGQLRIPQARELVLDYVVERKRMDDLCGSIIDGRFREQKFRLKRCGLRHPIYLVEDHGSAQHLSIPETTLQQAIVNTQVVDGFFIKRTKDVRESAAYLTIMTRYLQGIYSRKTLLSCTKEEEWKCDRALCPNTDSCILMEFKDFNESAMKNKAQTVKEVFARQLMQISGVSGEKAAAILEKYSTPASLMSAYESCSSTEEKEKLLSSVKCGKLQRNLGPVLSKTISQLYCTKEPLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry