Mouse Anti-Cattle ORC4 Antibody (MO-AB-17344R)


Cat: MO-AB-17344R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17344R
SpecificityThis antibody binds to Cattle ORC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene.
Product OverviewThis product is a mouse antibody against ORC4. It can be used for ORC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrigin recognition complex subunit 4; ORC4; ORC4L
UniProt IDQ2YDI2
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MSSRKSKSSNLIQADYISQVQRILRERFCHQSPHGNLFGVQVQYKHLIELLKRTAIHGESNSILIIGPRGSGKTMLINHALKELMEIEGVSENILQVHLNGLLQINDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPVIFILDEFDLFAHHKNQTLLYNLLDISQSAQTPVVIIGLTCRLDILELLEKRVKSRFSHRQIHLMNSFSFPQYLKIFKEQLSLPSVFPEEIFAEKWNENVQS.
For Research Use Only | Not For Clinical Use.
Online Inquiry