Mouse Anti-Rice ORC4 Antibody (CBMOAB-41924FYB)


Cat: CBMOAB-41924FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza)
CloneMO41924FYB
SpecificityThis antibody binds to Rice ORC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene.
Product OverviewMouse Anti-Rice ORC4 Antibody is a mouse antibody against ORC4. It can be used for ORC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrigin of replication complex subunit 4; OsORC4; ORC4; LOC_Os01g49010 Os01g0683400
UniProt IDQ5N8Q4
Protein RefseqThe length of the protein is 470 amino acids long.
The sequence is show below: MAAAAAAASVASQAQAVLRGRLCDQAVVHSALRSSPDTNYSKLKYLVASSVSEACNNSVLLLGPRGCGKAAVRFSFLVYSSAPLSAVFSDAGVVFDEMCQWAIYDFTLWVVSAWTEVVDMVLDDLKKDHPDAISVIRLNGMLHSDDNCATKEIARQLCLEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTIIFVLEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFVPSSVDSLQRLMEHLLALPEDSPLPTKYVREYNARITSIFNDKKFKGILSSLTDADATTSHILRFLFRVVSYMDIDSGLLSMQSFMNALSSMQRQPKMDSLQDLSILELYILVCMNRLEDKEKSSYNFITIMKEYKSVQDAYKTSDKYSHTVCFRAFEHLLDRELISFADNKGRNQALEYRPVKLLISSRELAESLKLNTTCPAVLQKLLDRERYM.
See other products for " orc4 "
CBMOAB-90949FYAMouse Anti-Zebrafish orc4 Antibody (CBMOAB-90949FYA)
MO-AB-70182WMouse Anti-Silkworm ORC4 Antibody (MO-AB-70182W)
MO-AB-17344RMouse Anti-Cattle ORC4 Antibody (MO-AB-17344R)
CBMOAB-37839FYCMouse Anti-Arabidopsis ORC4 Antibody (CBMOAB-37839FYC)
MO-AB-05903HMouse Anti-Frog orc4 Antibody (MO-AB-05903H)
MO-AB-43323WMouse Anti-Hamsters ORC4 Antibody (MO-AB-43323W)
CBMOAB-53591FYAMouse Anti-Rhesus ORC4 Antibody (CBMOAB-53591FYA)
MO-AB-48999WMouse Anti-Maize orc4 Antibody (MO-AB-48999W)
MO-AB-24744WMouse Anti-Chimpanzee ORC4 Antibody (MO-AB-24744W)
MO-AB-60748WMouse Anti-Marmoset ORC4 Antibody (MO-AB-60748W)
For Research Use Only | Not For Clinical Use.
Online Inquiry