Mouse Anti-Maize orc4 Antibody (MO-AB-48999W)


Cat: MO-AB-48999W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMaize (Zea mays)
CloneMO48999W
SpecificityThis antibody binds to Maize orc4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. This gene encodes a subunit of the ORC complex. Several alternatively spliced transcript variants, some of which encode the same protein, have been reported for this gene.
Product OverviewMouse Anti-Maize orc4 Antibody is a mouse antibody against orc4. It can be used for orc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrigin recognition complex subunit 4; orc4
UniProt IDQ945C5
Protein RefseqThe length of the protein is422 amino acids long.
The sequence is show below: MVAAVSLPSQAQAVLRSRLCDPVFIHSALSSSLDTNYSKLKYLVASSVSEACNNSVLLLGPRGCGKAAVVDMVLDDLKEEHPDAISVIRLNGMLHNDDNCAMKEIARQLCSEHQLSFSKMASSDDNTEFMIDMLRECGLAHKTILFILEEFDLFAQGKQRLLYSLLDAMQSLTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFISPSLDDMQRLVEHLLILAKDSGLPSKYIADYNSRLTSIFSDKKFKGCLNSLMDADATTSNIQRFLFRAVSYMDMESGFLSVESFLKALSSMQRQPKMDSLQDLSILELYILVCMHRLESKEQTSYNFTRIMKEYRSIQDAYKTSDKYASTVCFRAFEHLLDRELISFGDNRWRNQALEYRPVKLLISSRELAESLKLNTTCPAVLQKLFDRERYM.
For Research Use Only | Not For Clinical Use.
Online Inquiry