Mouse Anti-Cattle OXA1L Antibody (MO-AB-17404R)


Cat: MO-AB-17404R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17404R
SpecificityThis antibody binds to Cattle OXA1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an evolutionarily conserved protein that is localized to the inner mitochondrial membrane. The encoded protein is essential for the translocation of the N-terminal tail of subunit 2 of cytochrome c oxidase, and is involved in the assembly of the cytochrome c oxidase and ATPase complexes of the mitochondrial respiratory chain.
Product OverviewThis product is a mouse antibody against OXA1L. It can be used for OXA1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial inner membrane protein OXA1L; Oxidase assembly 1-like protein; OXA1-like protein; OXA1L
UniProt IDQ3SYV3
Protein RefseqThe length of the protein is 441 amino acids long.
The sequence is show below: MALALMCGRRQLLCLLRPQRQFHSVAGPCQWPRKPLTAGLGFPADRCLGHPRYVLLMAPGPRGLSTSAVSFGEAQVPAPPVIPATPPPTAVPEVASGEAADVIQAAAEQSFAELGLGSYTPVGLIQNLLEFMHVNLGLPWWGAIAACTVLARCLVFPLIVKGQREAAKIHNHLPEIQKFSARIREAKLTGNHTEFYRASSEMTFYQKKHDIKLFRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLWWFQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry