Mouse Anti-Rabbit OXA1L Antibody (MO-AB-09265Y)
Cat: MO-AB-09265Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus) |
| Clone | MO09265Y |
| Specificity | This antibody binds to Rabbit OXA1L. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an evolutionarily conserved protein that is localized to the inner mitochondrial membrane. The encoded protein is essential for the translocation of the N-terminal tail of subunit 2 of cytochrome c oxidase, and is involved in the assembly of the cytochrome c oxidase and ATPase complexes of the mitochondrial respiratory chain. |
| Product Overview | This product is a mouse antibody against OXA1L. It can be used for OXA1L detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Oxidase assembly 1-like protein; OXA1L |
| UniProt ID | H2CNB5 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: YRASSEMTLYQKKHDIKLLRPLILPLTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPTYILPMVVTATMWGVLE. |
See other products for " OXA1L "
| CBMOAB-53682FYA | Mouse Anti-Rhesus OXA1L Antibody (CBMOAB-53682FYA) |
| CBMOAB-37937FYC | Mouse Anti-Arabidopsis OXA1L Antibody (CBMOAB-37937FYC) |
| CBMOAB-91133FYA | Mouse Anti-Zebrafish oxa1l Antibody (CBMOAB-91133FYA) |
| MO-AB-17404R | Mouse Anti-Cattle OXA1L Antibody (MO-AB-17404R) |
| MO-DKB-03521W | Rabbit Anti-OXA1L (C-terminal) Antibody (Cat MO-DKB-03521W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry