Rabbit Anti-OXA1L (C-terminal) Antibody (Cat MO-DKB-03521W)
Cat: MO-DKB-03521W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Specificity | This antibody is binds to Human OXA1L and has cross reactivity with Mouse, Rat, Cattle, Dog, Horse, Guinea pig, Rabbit, Zebrafish OXA1L. |
| Immunogen | A synthetic peptide targeting the C-terminal region of human OXA1L. Peptide sequence: NAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS The peptide sequence of the immunogen was taken from the region. |
| Epitope | C-terminal |
| Format | Liquid or Lyophilized |
| Buffer | PBS, 2% Sucrose. |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purification | Affinity purified |
Application Information
| Application | WB |
| Application Notes | Western Blot: 1.0 ug/mL The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an evolutionarily conserved protein that is localized to the inner mitochondrial membrane. The encoded protein is essential for the translocation of the N-terminal tail of subunit 2 of cytochrome c oxidase, and is involved in the assembly of the cytochrome c oxidase and ATPase complexes of the mitochondrial respiratory chain. |
| Product Overview | This product is a Rabbit antibody against the OXA1L. It can be used for OXA1L detection in Western Blot. |
| Alternative Names | Zgc:163091 protein; oxa1l; zgc:16309 |
| UniProt ID | A3KP98 |
See other products for " oxa1l "
| CBMOAB-91133FYA | Mouse Anti-Zebrafish oxa1l Antibody (CBMOAB-91133FYA) |
| MO-AB-09265Y | Mouse Anti-Rabbit OXA1L Antibody (MO-AB-09265Y) |
| MO-AB-17404R | Mouse Anti-Cattle OXA1L Antibody (MO-AB-17404R) |
| CBMOAB-37937FYC | Mouse Anti-Arabidopsis OXA1L Antibody (CBMOAB-37937FYC) |
| CBMOAB-53682FYA | Mouse Anti-Rhesus OXA1L Antibody (CBMOAB-53682FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry