Mouse Anti-Cattle PARP1 Antibody (MO-AB-17564R)


Cat: MO-AB-17564R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO17564R
SpecificityThis antibody binds to Cattle PARP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionParticipates in the base excision repair (BER) pathway by catalyzing the poly(ADP-ribosylation) of a limited number of receptor proteins involved in chromatin structure and DNA metabolism. This modification follows DNA damage and occurs as a mandatory step in the detection/signaling pathway, leading to the repair of DNA strand breaks (PubMed:17177976, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:23230272). Mediates poly(ADP-ribosylation) of APLF and CHFR (PubMed:17396150). Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. Together with EEF1A1 and TXK, form a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-γ to directly regulate its transcription, thus playing an important role in Th1 cytokine production (PubMed: 17177976). Recruitment of PARP9 and DTX3L to DNA damage sites is required (PubMed:23230272). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80 and BRCA1 to sites of DNA damage (PubMed:23230272). Mediates serine ADP ribosylation of target proteins after interaction with HPF1; HPF1 confers serine specificity (PubMed:28190768). Mediates histone multimerization (ADP-ribosylation) in an HPF1-dependent manner (PubMed:27067600). Involved in ATP synthesis in the nucleus along with NMNAT1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP production is required for energy-intensive chromatin remodeling events (PubMed:27257257).
Product OverviewThis product is a mouse antibody against PARP1. It can be used for PARP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPoly [ADP-ribose] polymerase 1; PARP-1; EC 2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1; PARP1; ADPRT
UniProt IDP18493
Protein RefseqThe length of the protein is 1016 amino acids long.
The sequence is show below: MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMFDGKIPHWYHLSCFWKVGFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGRTDVSGKGQDGVGSKTEKTLIDFGAGYAKSNRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSATHLMGFSVLTAEDQETLKKQLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKALKAQNDLIWNVKDEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry