Mouse Anti-Cattle PARP1 Antibody (MO-AB-17564R)
Cat: MO-AB-17564R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO17564R |
Specificity | This antibody binds to Cattle PARP1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Participates in the base excision repair (BER) pathway by catalyzing the poly(ADP-ribosylation) of a limited number of receptor proteins involved in chromatin structure and DNA metabolism. This modification follows DNA damage and occurs as a mandatory step in the detection/signaling pathway, leading to the repair of DNA strand breaks (PubMed:17177976, PubMed:18172500, PubMed:19344625, PubMed:19661379, PubMed:23230272). Mediates poly(ADP-ribosylation) of APLF and CHFR (PubMed:17396150). Positively regulates the transcription of MTUS1 and negatively regulates the transcription of MTUS2/TIP150. Together with EEF1A1 and TXK, form a complex that acts as a T helper 1 (Th1) cell-specific transcription factor and binds the promoter of IFN-γ to directly regulate its transcription, thus playing an important role in Th1 cytokine production (PubMed: 17177976). Recruitment of PARP9 and DTX3L to DNA damage sites is required (PubMed:23230272). PARP1-dependent PARP9-DTX3L-mediated ubiquitination promotes rapid and specific recruitment of 53BP1/TP53BP1, UIMC1/RAP80 and BRCA1 to sites of DNA damage (PubMed:23230272). Mediates serine ADP ribosylation of target proteins after interaction with HPF1; HPF1 confers serine specificity (PubMed:28190768). Mediates histone multimerization (ADP-ribosylation) in an HPF1-dependent manner (PubMed:27067600). Involved in ATP synthesis in the nucleus along with NMNAT1, PARG and NUDT5 (PubMed:27257257). Nuclear ATP production is required for energy-intensive chromatin remodeling events (PubMed:27257257). |
Product Overview | This product is a mouse antibody against PARP1. It can be used for PARP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Poly [ADP-ribose] polymerase 1; PARP-1; EC 2.4.2.30; ADP-ribosyltransferase diphtheria toxin-like 1; ARTD1; NAD(+) ADP-ribosyltransferase 1; ADPRT 1; Poly[ADP-ribose] synthase 1; PARP1; ADPRT |
UniProt ID | P18493 |
Protein Refseq | The length of the protein is 1016 amino acids long. The sequence is show below: MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVESPMFDGKIPHWYHLSCFWKVGFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGRTDVSGKGQDGVGSKTEKTLIDFGAGYAKSNRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSATHLMGFSVLTAEDQETLKKQLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKALKAQNDLIWNVKDEL. |
See other products for " PARP1 "
CBMOAB-88473FYB | Mouse Anti-Rice PARP1 Antibody (CBMOAB-88473FYB) |
MO-AB-11857W | Mouse Anti-Chimpanzee PARP1 Antibody (MO-AB-11857W) |
MO-AB-43341W | Mouse Anti-Hamsters PARP1 Antibody (MO-AB-43341W) |
CBMOAB-38137FYC | Mouse Anti-Arabidopsis PARP1 Antibody (CBMOAB-38137FYC) |
MOF032922W121 | Mouse Anti-PARP1 Antibody (MOF032922W121) |
MO-AB-17027Y | Mouse Anti-Sheep Parp1 Antibody (MO-AB-17027Y) |
MO-AB-61017W | Mouse Anti-Marmoset PARP1 Antibody (MO-AB-61017W) |
MO-AB-03331Y | Mouse Anti-Chicken PARP1 Antibody (MO-AB-03331Y) |
MO-AB-06020H | Mouse Anti-Frog parp1 Antibody (MO-AB-06020H) |
CBMOAB-91452FYA | Mouse Anti-Zebrafish parp1 Antibody (CBMOAB-91452FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry