Mouse Anti-Cattle RHO Antibody (MO-AB-19269R)


Cat: MO-AB-19269R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO19269R
SpecificityThis antibody binds to Cattle RHO.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRhodopsin (also called visual purple) is a photosensitive receptor protein involved in visual light transduction. Rhodopsin is a biological pigment found in the rods of the retina, and is a G protein coupled receptor (GPCR). It belongs to opsins. Rhodopsin is extremely sensitive to light, so vision can be achieved in low-light conditions. When rhodopsin is exposed to light, it will bleach immediately. In humans, it fully regenerates in about 30 minutes, after which the rod is more sensitive. The photoactivation product Metarhodopsin II stimulates the G protein transduction protein (Gt) to trigger the visual light transduction pathway, thereby releasing its alpha subunit. This GTP-bound subunit in turn activates cGMP phosphodiesterase. cGMP phosphodiesterase hydrolyzes (decomposes) cGMP, reducing its local concentration, so it can no longer activate cGMP-dependent cation channels. This leads to hyperpolarization of photoreceptor cells, changing the rate at which they release the emitter.
Product OverviewThis product is a mouse antibody against RHO. It can be used for RHO detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRhodopsin; RHO
UniProt IDP02699
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVI.
For Research Use Only | Not For Clinical Use.
Online Inquiry