Mouse Anti-Zebrafish rho Antibody (CBMOAB-95915FYA)


Cat: CBMOAB-95915FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO95915FYA
SpecificityThis antibody binds to Zebrafish rho.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is found in rod cells in the back of the eye and is essential for vision in low-light conditions. The encoded protein binds to 11-cis retinal and is activated when light hits the retinal molecule. Defects in this gene are a cause of congenital stationary night blindness.
Product OverviewMouse Anti-Zebrafish rho Antibody is a mouse antibody against rho. It can be used for rho detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRhodopsin; rho; RH
UniProt IDQ8AV67
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: MNGTEGPAFYVPMSNATGVVRSPYEYPQYYLVAPWAYGLLAAYMFFLIITGFPVNFLTLYVTIEHKKLRTPLNYILLNLAIADLFMVFGGFTTTMYTSLHGYFVFGRLGCNLEGFFATLGGEMGLWSLVVLAIERWMVVCKPVSNFRFGENHAIMGVAFTWVMACSCAVPPLVGWSRYIPEGMQCSCGVDYYTRTPGVNNESFVIYMFIVHFFIPLIVIFFCYGRLVCTVKEAAAQQQESETTQRAEREVTRMVIIMVIAFLICWVPYAGVAWYIFTHQGSEFGPVFMTLPAFFAKTSAVYNPCIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTASKTEASSVSSSSVSPA.
See other products for " RHO "
MO-AB-28804RMouse Anti-Pig RHO Antibody (MO-AB-28804R)
CBMOAB-2329YCMouse Anti-E. coli rho Antibody (CBMOAB-2329YC)
MO-AB-43399WMouse Anti-Hamsters RHO Antibody (MO-AB-43399W)
MO-AB-07103HMouse Anti-Frog rho Antibody (MO-AB-07103H)
MO-AB-20826WMouse Anti-Chimpanzee RHO Antibody (MO-AB-20826W)
MO-AB-06840YMouse Anti-O. anatinus RHO Antibody (MO-AB-06840Y)
MO-NAB-00459WMouse Anti-RHO Antibody
MO-AB-17481YMouse Anti-Sheep RHO Antibody (MO-AB-17481Y)
CBMOAB-29651FYAMouse Anti-D. melanogaster Rho Antibody (CBMOAB-29651FYA)
MO-NAB-00437WRabbit Anti-RHO Antibody
For Research Use Only | Not For Clinical Use.
Online Inquiry