Mouse Anti-O. anatinus RHO Antibody (MO-AB-06840Y)
Cat: MO-AB-06840Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | O. anatinus (Ornithorhynchus anatinus) |
| Clone | MO06840Y |
| Specificity | This antibody binds to O. anatinus RHO. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Plasma membrane; Golgi apparatus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Rhodopsin (also called visual purple) is a photosensitive receptor protein involved in visual light transduction. Rhodopsin is a biological pigment found in the rods of the retina, and is a G protein coupled receptor (GPCR). It belongs to opsins. Rhodopsin is extremely sensitive to light, so vision can be achieved in low-light conditions. When rhodopsin is exposed to light, it will bleach immediately. In humans, it fully regenerates in about 30 minutes, after which the rod is more sensitive. The photoactivation product Metarhodopsin II stimulates the G protein transduction protein (Gt) to trigger the visual light transduction pathway, thereby releasing its alpha subunit. This GTP-bound subunit in turn activates cGMP phosphodiesterase. cGMP phosphodiesterase hydrolyzes (decomposes) cGMP, reducing its local concentration, so it can no longer activate cGMP-dependent cation channels. This leads to hyperpolarization of photoreceptor cells, changing the rate at which they release the emitter. |
| Product Overview | This product is a mouse antibody against RHO. It can be used for RHO detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Rhodopsin; RHO |
| UniProt ID | A4ZIS8 |
| Protein Refseq | The length of the protein is 353 amino acids long. The sequence is show below: MNGTEGQDFYIPMSNKTGVVRSPFEYPQYYLAEPWQYSVLAAYMFMLIMLGFPINFLTLYVTIQHKKLRTPLNYILLNLAFANHFMVLGGFTTTLYTSLHGYFVFGPTGCNIEGFFATLGGEIALWSLVVLAIERYIVVCKPMSNFRFGENHAIMGVAFTWIMALACALPPLVGWSRYIPEGMQCSCGIDYYTLRPEVNNESFVIYMFVVHFTIPMTIIFFCYGRLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTVPAFFAKSSAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATASKTEQSSVSTSQVSPA. |
See other products for " RHO "
| MO-AB-28804R | Mouse Anti-Pig RHO Antibody (MO-AB-28804R) |
| MO-NAB-00008W | Mouse Anti-RHO Antibody (MO-NAB-00008W) |
| MO-AB-19269R | Mouse Anti-Cattle RHO Antibody (MO-AB-19269R) |
| MO-AB-33072W | Mouse Anti-Dog RHO Antibody (MO-AB-33072W) |
| MO-DKB-00262W | Rabbit Anti-rho Antibody (MO-DKB-00262W) |
| MO-AB-17481Y | Mouse Anti-Sheep RHO Antibody (MO-AB-17481Y) |
| MO-NAB-00437W | Rabbit Anti-RHO Antibody |
| MO-AB-63283W | Mouse Anti-Marmoset RHO Antibody (MO-AB-63283W) |
| CBMOAB-95915FYA | Mouse Anti-Zebrafish rho Antibody (CBMOAB-95915FYA) |
| MO-NAB-00459W | Mouse Anti-RHO Antibody |
For Research Use Only | Not For Clinical Use.
Online Inquiry