Rabbit Anti-CBS (N-terminal) Antibody (Cat MO-DKB-03339W)
Cat: MO-DKB-03339W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Horse (Equus caballus), Guinea pig (Cavia porcellus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) |
| Specificity | This antibody is binds to Human CBS and has cross reactivity with Mouse, Rat, Cattle, Dog, Horse, Guinea pig, Rabbit, Zebrafish CBS. |
| Immunogen | The synthetic peptide peptide sequence corresponding to CBS (cystathionine-β-synthase) is selected from the N-terminus of CBS. Peptide sequence RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE. The peptide sequence of the immunogen was taken from the region. |
| Epitope | N-terminal |
| Format | Liquid or Lyophilized |
| Buffer | PBS, 2% Sucrose |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purification | Protein A purified |
Application Information
| Application | WB, IHC, IHC-P |
| Application Notes | Western Blot: 1.0 ug/mL Immunohistochemistry: 1:10-1:500 Immunohistochemistry-Paraffin: 1:10-1:500 The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene acts as a homotetramer to catalyze the conversion of homocysteine to cystathionine, the first step in the transsulfuration pathway. The encoded protein is allosterically activated by adenosyl-methionine and uses pyridoxal phosphate as a cofactor. Defects in this gene can cause cystathionine beta-synthase deficiency (CBSD), which can lead to homocystinuria. This gene is a major contributor to cellular hydrogen sulfide production. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Feb 2016] |
| Product Overview | This product is a Rabbit antibody against the CBS. It can be used for CBS detection in Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Alternative Names | Cystathionine-Beta-Synthase; Serine Sulfhydrase; Beta-Thionase; EC 4.2.1.22; Cystathionine Beta-Synthase; Methylcysteine Synthase; HIP4; |
| Gene ID | 875 |
| UniProt ID | P35520 |
See other products for " cbs "
| MO-AB-02119H | Mouse Anti-Frog cbs Antibody (MO-AB-02119H) |
| MO-AB-08893W | Mouse Anti-Cat CBS Antibody (MO-AB-08893W) |
| MO-AB-03469W | Mouse Anti-Rhesus CBS Antibody (MO-AB-03469W) |
| MO-AB-07454Y | Mouse Anti-Rabbit CBS Antibody (MO-AB-07454Y) |
| MO-AB-41350W | Mouse Anti-Guinea pig Cbs Antibody (MO-AB-41350W) |
| MO-NAB-00148W | Mouse Anti-E. coli CBS (AA 1-100, clone 6A9) Antibody (MO-NAB-00148W) |
| MO-AB-21886W | Mouse Anti-Chimpanzee CBS Antibody (MO-AB-21886W) |
| MO-AB-02333W | Mouse Anti-Fruit fly Cbs Antibody (MO-AB-02333W) |
| MO-AB-24361R | Mouse Anti-Pig CBS Antibody (MO-AB-24361R) |
| MO-AB-52321W | Mouse Anti-Marmoset CBS Antibody (MO-AB-52321W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry