Mouse Anti-Chimpanzee APOB Antibody (MO-AB-26805W)
Cat: MO-AB-26805W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO26805W |
Specificity | This antibody binds to Chimpanzee APOB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. |
Product Overview | Mouse Anti-Chimpanzee APOB Antibody is a mouse antibody against APOB. It can be used for APOB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Apolipoprotein B; APOB |
UniProt ID | Q866M1 |
Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: NTLHLVSTTKTEVIPPLIENRQSWSVCKQVFPGLNYCTSGAYSNASSTDSASYYPLTGDT. |
See other products for " APOB "
MO-AB-23811R | Mouse Anti-Pig APOB Antibody (MO-AB-23811R) |
MO-AB-00091L | Mouse Anti-Elephant ApoB Antibody (MO-AB-00091L) |
MO-AB-22960H | Mouse Anti-Mallard apob Antibody (MO-AB-22960H) |
MO-AB-42937W | Mouse Anti-Hamsters ApoB Antibody (MO-AB-42937W) |
MOFY-0722-FY356 | Rabbit Anti-APOB Antibody (MOFY-0722-FY356) |
CBMOAB-36014FYA | Mouse Anti-Rhesus APOB Antibody (CBMOAB-36014FYA) |
MO-AB-24112H | Mouse Anti-Rat apoB Antibody (MO-AB-24112H) |
MO-AB-00153Y | Mouse Anti-Chicken APOB Antibody (MO-AB-00153Y) |
MO-AB-07226Y | Mouse Anti-Rabbit APOB Antibody (MO-AB-07226Y) |
MO-AB-34401W | Mouse Anti-Ferret APOB Antibody (MO-AB-34401W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry