Mouse Anti-Chimpanzee ccs Antibody (MO-AB-13536W)


Cat: MO-AB-13536W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO13536W
SpecificityThis antibody binds to Chimpanzee ccs.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCS (Copper Chaperone For Superoxide Dismutase) is a Protein Coding gene. Diseases associated with CCS include Entropion and Amyotrophic Lateral Sclerosis 1. Among its related pathways are Detoxification of Reactive Oxygen Species and Amyotrophic lateral sclerosis (ALS). Gene Ontology (GO) annotations related to this gene include copper ion binding and copper ion transmembrane transporter activity. An important paralog of this gene is SOD1.
Product OverviewMouse Anti-Chimpanzee ccs Antibody is a mouse antibody against ccs. It can be used for ccs detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCopper chaperone for superoxide dismutase; ccs
UniProt IDD2KTB8
Protein RefseqThe length of the protein is 274 amino acids long.
The sequence is show below: MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL.
See other products for " CCS "
CBMOAB-22087FYBMouse Anti-Rice CCS Antibody (CBMOAB-22087FYB)
MO-AB-24604HMouse Anti-Rat Ccs Antibody (MO-AB-24604H)
MO-AB-34255HMouse Anti-Tomato CCS Antibody (MO-AB-34255H)
MO-AB-31217HMouse Anti-Soybean CCS Antibody (MO-AB-31217H)
CBMOAB-03199FYAMouse Anti-D. melanogaster Ccs Antibody (CBMOAB-03199FYA)
MO-AB-02188HMouse Anti-Frog ccs Antibody (MO-AB-02188H)
MO-AB-38923WMouse Anti-Grape CCS Antibody (MO-AB-38923W)
CBMOAB-69630FYAMouse Anti-Zebrafish ccs Antibody (CBMOAB-69630FYA)
MO-AB-52508WMouse Anti-Marmoset CCS Antibody (MO-AB-52508W)
MO-AB-09748RMouse Anti-Cattle CCS Antibody (MO-AB-09748R)
For Research Use Only | Not For Clinical Use.
Online Inquiry