Mouse Anti-Marmoset CCS Antibody (MO-AB-52508W)


Cat: MO-AB-52508W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52508W
SpecificityThis antibody binds to Marmoset CCS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCS (Copper Chaperone For Superoxide Dismutase) is a Protein Coding gene. Diseases associated with CCS include Entropion and Amyotrophic Lateral Sclerosis 1. Among its related pathways are Detoxification of Reactive Oxygen Species and Amyotrophic lateral sclerosis (ALS). Gene Ontology (GO) annotations related to this gene include copper ion binding and copper ion transmembrane transporter activity. An important paralog of this gene is SOD1.
Product OverviewMouse Anti-Marmoset CCS Antibody is a mouse antibody against CCS. It can be used for CCS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCopper chaperone for superoxide dismutase; CCS
UniProt IDF7ITC5
Protein RefseqThe length of the protein is 274 amino acids long.
The sequence is show below: MASDSGTQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLENQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPEHCLIEGTIDGLEPGLHGLHVHQYGDLTKNCNSCGDHFNPDGTSHGGPQDSDRHRGDLGNVCADADGRAIFRMEDRQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESVQTPAHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry