Mouse Anti-Chimpanzee CTSS Antibody (MO-AB-19418W)


Cat: MO-AB-19418W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO19418W
SpecificityThis antibody binds to Chimpanzee CTSS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Lysosome; Endosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTSS (Cathepsin S) is a Protein Coding gene. Diseases associated with CTSS include Cercarial Dermatitis and Mandibular Cancer. Among its related pathways are Bacterial infections in CF airways and Innate Immune System. Gene Ontology (GO) annotations related to this gene include peptidase activity and cysteine-type peptidase activity. An important paralog of this gene is CTSK.
Product OverviewMouse Anti-Chimpanzee CTSS Antibody is a mouse antibody against CTSS. It can be used for CTSS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin S; CTSS
UniProt IDH2PZX3
Protein RefseqThe length of the protein is 331 amino acids long.
The sequence is show below: MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNQILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKATDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDALHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI.
See other products for " CTSS "
MO-AB-53727WMouse Anti-Marmoset CTSS Antibody (MO-AB-53727W)
MO-AB-14776YMouse Anti-Sheep CTSS Antibody (MO-AB-14776Y)
MO-AB-00282RMouse Anti-Medaka ctsS Antibody (MO-AB-00282R)
MO-AB-02745HMouse Anti-Frog ctss Antibody (MO-AB-02745H)
MO-AB-44219WMouse Anti-Horse CTSS Antibody (MO-AB-44219W)
MO-AB-10936RMouse Anti-Cattle CTSS Antibody (MO-AB-10936R)
MOFY-0722-FY334Rabbit Anti-CTSS Antibody (MOFY-0722-FY334)
MO-AB-29946WMouse Anti-Dog CTSS Antibody (MO-AB-29946W)
CBMOAB-40098FYAMouse Anti-Rhesus CTSS Antibody (CBMOAB-40098FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry