Mouse Anti-Medaka ctsS Antibody (MO-AB-00282R)


Cat: MO-AB-00282R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMedaka (Oryzias latipes)
CloneMO00282R
SpecificityThis antibody binds to Medaka ctsS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCTSS (Cathepsin S) is a Protein Coding gene. Diseases associated with CTSS include Cercarial Dermatitis and Mandibular Cancer. Among its related pathways are Bacterial infections in CF airways and Innate Immune System. Gene Ontology (GO) annotations related to this gene include peptidase activity and cysteine-type peptidase activity. An important paralog of this gene is CTSK.
Product OverviewThis product is a mouse antibody against ctsS. It can be used for ctsS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCathepsin S; ctsS; ctss
UniProt IDQ6F6A0
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MFWRLFFTVLCGFVPAVRSHLDQHWNLWKKTYSKTYSHEIEEFGRRRIWEENLEMISVHNLEVSLGLHSYELAMNHLGDLTIEELIASLTGTVAPVGLERIHYDLVKINTSVPESVDWREGGLVTSVKTQGRCGSCWAFSAVGALEGQLKKTTGILTSLSPQNLVDCSTKYGNYGCKGGFMSNAFQYVIKNQGISSDAAYPYIGKRDKCKYDSKHRAANCTGYNFLPKGDEFALKVGVATIGPISVAIDASRPKFLFYRHGVYKDHSCSHNVNHGVLVVGYGTENGEDYWLVKNSWGERYGDGGYIKMARNRRNQCGIALYACFPVM.
See other products for " CTSS "
MO-AB-14776YMouse Anti-Sheep CTSS Antibody (MO-AB-14776Y)
MO-AB-10936RMouse Anti-Cattle CTSS Antibody (MO-AB-10936R)
MOFY-0722-FY334Rabbit Anti-CTSS Antibody (MOFY-0722-FY334)
MO-AB-44219WMouse Anti-Horse CTSS Antibody (MO-AB-44219W)
MO-AB-29946WMouse Anti-Dog CTSS Antibody (MO-AB-29946W)
CBMOAB-40098FYAMouse Anti-Rhesus CTSS Antibody (CBMOAB-40098FYA)
MO-AB-53727WMouse Anti-Marmoset CTSS Antibody (MO-AB-53727W)
MO-AB-02745HMouse Anti-Frog ctss Antibody (MO-AB-02745H)
MO-AB-19418WMouse Anti-Chimpanzee CTSS Antibody (MO-AB-19418W)
For Research Use Only | Not For Clinical Use.
Online Inquiry