Mouse Anti-Chimpanzee SPP1 Antibody (MO-AB-22634W)


Cat: MO-AB-22634W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO22634W
SpecificityThis antibody binds to Chimpanzee SPP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. The encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. This protein is also a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Chimpanzee SPP1 Antibody is a mouse antibody against SPP1. It can be used for SPP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSecreted phosphoprotein 1; SPP1
UniProt IDH2RCV1
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: MRIAVICFCLLGITCALPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQKQNLLAPQNAVSSEETNDFKQETLPSKSNESHDHMDDVDDEDDDDHVDSQDSIDSNDSDDVDDTDDSHQSDESHHSDESDELVTDFPTDLPATEVFTPVVPTVDTYDGRGDSVVYGLRSKSKKFRRPDIQYPDAIDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKASDESNEHSDVIDSKELSKVSREFHSHEFHSQGDMLVVDPKSKEEDKHLKFRISHELDSASSEVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry