Mouse Anti-ciapin1 Antibody (MO-AB-32910H)
Cat: MO-AB-32910H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-32910H | Monoclonal | Nile tilapia (Oreochromis niloticus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO32910C | 100 µg | ||
CBMOAB-39265FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39265FYA | 100 µg | ||
CBMOAB-70535FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70535FYA | 100 µg | ||
MO-AB-07860W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07860W | 100 µg | ||
MO-AB-29552W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29552W | 100 µg | ||
MO-AB-34563W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34563W | 100 µg | ||
MO-AB-43012W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43012W | 100 µg | ||
MO-AB-44052W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44052W | 100 µg | ||
MO-AB-53028W | Monoclonal | Marmoset | WB, ELISA | MO53028W | 100 µg | ||
MO-AB-10243R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10243R | 100 µg | ||
MO-AB-10906Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10906Y | 100 µg | ||
MO-AB-14567Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14567Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Nile tilapia (Oreochromis niloticus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO32910C |
Specificity | This antibody binds to Nile tilapia ciapin1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CIAPIN1 is a cytokine-induced inhibitor of apoptosis with no relation to apoptosis regulatory molecules of the BCL2 (MIM 151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is dependent on growth factor stimulation. |
Product Overview | This product is a mouse antibody against ciapin1. It can be used for ciapin1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Anamorsin; Cytokine-induced apoptosis inhibitor 1; Fe-S cluster assembly protein DRE2 homolog; LOC100712254; ciapin1 |
UniProt ID | I3JXX5 |
Protein Refseq | The length of the protein is 313 amino acids long. The sequence is show below: MADLGIRAGDKVLLVWAQPSTPTALKQYAEELGAVVGADGRVAVENMERLLLSSHAASTFDWVLSCLLADSSSIHTSETLAEIARVLKPGGRLVLDEPVTGSEGQSVKTAEKLVSALKLSGFMSVTEVSKAELSPEALSSLRTASGYQGDTLSRVRVSASKPDFEVGSSSQIKLSFGKKTAKPAEKPALDPNTVKMWTLSANDMNDDDVDLMDSDALLDEDDLKKPDPASLKAPGCGEGAGKKKKACKNCTCGLAEELEQESKGKQKTDLPKSACGSCYLGDAFRCASCPYLGMPAFKPGEKIVLDNTTLTDA. |
See other products for " CIAPIN1 "
MO-AB-38464W | Mouse Anti-CIAPIN1 Antibody (MO-AB-38464W) |
MO-AB-00205R | Mouse Anti-ciapin1 Antibody (MO-AB-00205R) |
CBMOAB-13536FYA | Mouse Anti-Ciapin1 Antibody (CBMOAB-13536FYA) |
MO-AB-07585Y | Mouse Anti-CIAPIN1 Antibody (MO-AB-07585Y) |
MO-AB-24610R | Mouse Anti-CIAPIN1 Antibody (MO-AB-24610R) |
MO-AB-11379W | Mouse Anti-CIAPIN1 Antibody (MO-AB-11379W) |
MO-AB-41397W | Mouse Anti-CIAPIN1 Antibody (MO-AB-41397W) |
MO-AB-00215L | Mouse Anti-CIAPIN1 Antibody (MO-AB-00215L) |
For Research Use Only | Not For Clinical Use.
Online Inquiry