AibGenesis™ Mouse Anti-CIAPIN1 Antibody (MO-AB-41397W)
Cat: MO-AB-41397W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-41397W | Monoclonal | Guinea pig (Cavia porcellus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO41397W | 100 µg | ||
| CBMOAB-39265FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39265FYA | 100 µg | ||
| CBMOAB-70535FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70535FYA | 100 µg | ||
| MO-AB-07860W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07860W | 100 µg | ||
| MO-AB-29552W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29552W | 100 µg | ||
| MO-AB-34563W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34563W | 100 µg | ||
| MO-AB-43012W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43012W | 100 µg | ||
| MO-AB-44052W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44052W | 100 µg | ||
| MO-AB-53028W | Monoclonal | Marmoset | WB, ELISA | MO53028W | 100 µg | ||
| MO-AB-10243R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10243R | 100 µg | ||
| MO-AB-10906Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10906Y | 100 µg | ||
| MO-AB-14567Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14567Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Guinea pig (Cavia porcellus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO41397W |
| Specificity | This antibody binds to Guinea pig CIAPIN1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Guinea pig CIAPIN1 Antibody is a mouse antibody against CIAPIN1. It can be used for CIAPIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Anamorsin; Cytokine-induced apoptosis inhibitor 1; Fe-S cluster assembly protein DRE2 homolog; CIAPIN1; Ciapin1 |
| UniProt ID | H0W6W3 |
| Protein Refseq | The length of the protein is310 amino acids long. The sequence is show below: MAEFGISAGQLVAVIWDKSTPTEALKDLVDKLQGLTGSEDRVSVENIDQLLQSAHKESSFDIILSGVVPGSTTLHSAEVLAEMARILRPGGCLFLKEPVETAVVNNSKMKTASKLCSALTLSGLVEVKELQREPLSPGEVKSVQEHLGYNNNSLLIIQITGKKPNFEVGSSSQLNLSIIKKPSVKPAVDPAAAKLWTLSANDMEDEGMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSEAQKSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSNSSLHDA. |
See other products for " CIAPIN1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry