Mouse Anti-D. melanogaster Pex5 Antibody (CBMOAB-27484FYA)
Cat: CBMOAB-27484FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO27484FYA |
Specificity | This antibody binds to fruit fly Pex5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Peroxisome; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The product of this gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. |
Product Overview | Mouse Anti-D. melanogaster Pex5 Antibody is a mouse antibody against Pex5. It can be used for Pex5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GH08708p; Peroxin 5, isoform A; Pex5; arm EG:63B12.5 |
UniProt ID | O46085 |
Protein Refseq | The length of the protein is 614 amino acids long. The sequence is show below: MVQSGIWRSKPILWRIRFCAAIYFIIIRALCNTVTKPIASITADKQLRSISTSNTMSFRPLVEGDCGGVNPLMQLGGQFTRDVAHKDEGYVQRHFERAARPEDQLINEFLGQVTAPPQSFQMDTLLQEMRDINIHGNPQQQMHSQQAEQWGQDFARGLAPALPNKMIHMQAQQQDLQHAQEFFDEPLISSQNFRSLPPLRQPLMPIAAGQQQDPFFDSAMETIITDHLPQAPQGESLDDWISDYQRSTEQKEQTAANFNEKFWERLQDEWQKLADENEHPWLSEYNDNMDAYKEYEFAEGNPMSDVENPFEKGKEYLSKGDIPSAVLCFEVAAKKQPERAEVWQLLGTSQTENEMDPQAIAALKRAYDLQPDNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHPELQAEGTSLASSLIGPSKLRDLQQIYLEAVRQHPSEVDAEVQDALGVLYNLSGEFDKAVDCYQSALQVDPQNAKTWNRLGASLANGSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNLKAYKEAVEHLLTALTMQAHTNAARELPNAAMAATFRGQNQMSESIWSTLKMVISLMGRSDLQSYVSDRNLAALNEAFKD. |
See other products for " PEX5 "
MO-DKB-02810W | Rabbit Anti-PEX5 Antibody (MO-DKB-02810W) |
MO-AB-17787R | Mouse Anti-Cattle PEX5 Antibody (MO-AB-17787R) |
CBMOAB-54306FYA | Mouse Anti-Rhesus PEX5 Antibody (CBMOAB-54306FYA) |
MO-AB-12795W | Mouse Anti-Chimpanzee PEX5 Antibody (MO-AB-12795W) |
CBMOAB-88572FYB | Mouse Anti-Rice PEX5 Antibody (CBMOAB-88572FYB) |
MO-AB-43352W | Mouse Anti-Hamsters PEX5 Antibody (MO-AB-43352W) |
MO-AB-61331W | Mouse Anti-Marmoset PEX5 Antibody (MO-AB-61331W) |
MO-AB-05095W | Mouse Anti-Rhesus PEX5 Antibody (MO-AB-05095W) |
CBMOAB-02925CR | Mouse Anti-Yeast PEX5 Antibody (CBMOAB-02925CR) |
CBMOAB-92248FYA | Mouse Anti-Zebrafish pex5 Antibody (CBMOAB-92248FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry