Mouse Anti-D. melanogaster Pex5 Antibody (CBMOAB-27484FYA)


Cat: CBMOAB-27484FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO27484FYA
SpecificityThis antibody binds to fruit fly Pex5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Peroxisome; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-D. melanogaster Pex5 Antibody is a mouse antibody against Pex5. It can be used for Pex5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGH08708p; Peroxin 5, isoform A; Pex5; arm EG:63B12.5
UniProt IDO46085
Protein RefseqThe length of the protein is 614 amino acids long.
The sequence is show below: MVQSGIWRSKPILWRIRFCAAIYFIIIRALCNTVTKPIASITADKQLRSISTSNTMSFRPLVEGDCGGVNPLMQLGGQFTRDVAHKDEGYVQRHFERAARPEDQLINEFLGQVTAPPQSFQMDTLLQEMRDINIHGNPQQQMHSQQAEQWGQDFARGLAPALPNKMIHMQAQQQDLQHAQEFFDEPLISSQNFRSLPPLRQPLMPIAAGQQQDPFFDSAMETIITDHLPQAPQGESLDDWISDYQRSTEQKEQTAANFNEKFWERLQDEWQKLADENEHPWLSEYNDNMDAYKEYEFAEGNPMSDVENPFEKGKEYLSKGDIPSAVLCFEVAAKKQPERAEVWQLLGTSQTENEMDPQAIAALKRAYDLQPDNQQVLMALAACYTNEGLQNNAVRMLCNWLTVHPKYQHLVAAHPELQAEGTSLASSLIGPSKLRDLQQIYLEAVRQHPSEVDAEVQDALGVLYNLSGEFDKAVDCYQSALQVDPQNAKTWNRLGASLANGSRSVEAVEAYQQALQLQPGFIRVRYNVGVCCMNLKAYKEAVEHLLTALTMQAHTNAARELPNAAMAATFRGQNQMSESIWSTLKMVISLMGRSDLQSYVSDRNLAALNEAFKD.
See other products for " PEX5 "
MO-DKB-02810WRabbit Anti-PEX5 Antibody (MO-DKB-02810W)
MO-AB-17787RMouse Anti-Cattle PEX5 Antibody (MO-AB-17787R)
CBMOAB-54306FYAMouse Anti-Rhesus PEX5 Antibody (CBMOAB-54306FYA)
MO-AB-12795WMouse Anti-Chimpanzee PEX5 Antibody (MO-AB-12795W)
CBMOAB-88572FYBMouse Anti-Rice PEX5 Antibody (CBMOAB-88572FYB)
MO-AB-43352WMouse Anti-Hamsters PEX5 Antibody (MO-AB-43352W)
MO-AB-61331WMouse Anti-Marmoset PEX5 Antibody (MO-AB-61331W)
MO-AB-05095WMouse Anti-Rhesus PEX5 Antibody (MO-AB-05095W)
CBMOAB-02925CRMouse Anti-Yeast PEX5 Antibody (CBMOAB-02925CR)
CBMOAB-92248FYAMouse Anti-Zebrafish pex5 Antibody (CBMOAB-92248FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry